PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT21861
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 622aa    MW: 67870.1 Da    PI: 7.7696
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT21861genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.52.1e-31238295260
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
               dDgynWrKYGqK+vkgse+prsYY+Ct+++C+vkk +er+  d+ ++e++Y+g+Hnh+k
  EMT21861 238 DDGYNWRKYGQKHVKGSENPRSYYKCTHPNCEVKKLLERAV-DGLITEVVYKGRHNHPK 295
               8****************************************.***************85 PP

2WRKY107.37.8e-34411469159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+vkg+++prsYY+Cts+gCpv+k+ver+++dpk v++tYeg+Hnhe
  EMT21861 411 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSTGCPVRKHVERASHDPKSVITTYEGKHNHE 469
               59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-27230296IPR003657WRKY domain
PROSITE profilePS5081123.525232296IPR003657WRKY domain
SuperFamilySSF1182902.35E-24236296IPR003657WRKY domain
SMARTSM007747.1E-35237295IPR003657WRKY domain
PfamPF031064.7E-24238294IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.4E-38396471IPR003657WRKY domain
SuperFamilySSF1182901.24E-29403471IPR003657WRKY domain
PROSITE profilePS5081138.871406471IPR003657WRKY domain
SMARTSM007741.4E-39411470IPR003657WRKY domain
PfamPF031062.2E-26412469IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0010050Biological Processvegetative phase change
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MSPARLPISR EPCLTIPAGF SPSALLDSPV LLTNFKVIAA SLYCTYRLWP PVTTCYRGIC  60
RLYGVRVMLR ALSKETPPRL WPVILVVEPS PTTGSLSMAA IMHKSAHPDI LPSPRDKSIR  120
AHEDGGSRDF EFKPHLNSSS QSLAPAMSDL KKHKHSMQNQ SMNPSSSSSN MVNENRPPCS  180
RESSLTVNVS APNQPVGMVG LTDNMPAEVG TSEPQQMNSS DNAMQEPQSE NVADKSADDG  240
YNWRKYGQKH VKGSENPRSY YKCTHPNCEV KKLLERAVDG LITEVVYKGR HNHPKPQPNR  300
RLAGGAVPSN QGEERYDGAA AADDKSSNAL SNLANPVNSP GMVEPVPVSV SDDDIDAGGG  360
RPYPGDDATE EEDLELKRRK MESAGIDAAL MGKPNREPRV VVQTVSEVDI LDDGYRWRKY  420
GQKVVKGNPN PRSYYKCTST GCPVRKHVER ASHDPKSVIT TYEGKHNHEV PAARNATHEM  480
SAPPMKNVVH QINSNMPSSI GGMMRACEAR NFTNQYSQAA ETDTVSLDLG VGISPNHSDA  540
TNQMQSSGPD QMQYQMQSMA SMYGNMRHPS SMAVPTVQGN SAGRMYGSRE EKGNEGFTFR  600
ATPMDHSANL CYSGAGNLVM GP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-36238472878Probable WRKY transcription factor 4
2lex_A1e-36238472878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0138180.0HM013818.1 Triticum aestivum WRKY78 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562812.10.0PREDICTED: WRKY transcription factor SUSIBA2
SwissprotQ6VWJ60.0WRK46_HORVU; WRKY transcription factor SUSIBA2
TrEMBLM8CFC00.0M8CFC0_AEGTA; Putative WRKY transcription factor 20
STRINGBRADI1G23340.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67403851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-109WRKY family protein